FAM108C1 (ABHD17C) Rabbit Polyclonal Antibody TA335493 from OriGene Technologies | Biocompare.com

Supplier Images

FAM108C1 (ABHD17C) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM108C1 (ABHD17C) Rabbit Polyclonal Antibody

OriGene Technologies' FAM108C1 (ABHD17C) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-ABHD17C Antibody

Product Specs
ItemFAM108C1 (ABHD17C) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA335493
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetABHD17C
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-FAM108C1 Antibody is: synthetic peptide directed towards the middle region of Human FAM108C1. Synthetic peptide located within the following region: GSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENI
NCBI Full Gene Nameabhydrolase domain containing 17C, depalmitoylase
NCBI Gene AliasesFAM108C1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!